PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA32G00526
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 471aa    MW: 52083.1 Da    PI: 5.4109
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA32G00526genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.1e-161966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l ++v+++G g+W+++ +  g+ R++k+c++rw ++l
       AA32G00526 19 KGPWTATEDAILTEYVRKHGEGNWNAVQKNSGLLRCGKSCRLRWANHL 66
                     79******************************99**********9986 PP

2Myb_DNA-binding50.74e-1672115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+++++E+ l++++++++G++ W++ a+ ++ gRt++++k++w++
       AA32G00526  72 KGSFSPDEERLIIELHAKHGNK-WARMASQLP-GRTDNEIKNYWNT 115
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.7381466IPR017930Myb domain
SuperFamilySSF466891.09E-2916113IPR009057Homeodomain-like
SMARTSM007172.9E-141868IPR001005SANT/Myb domain
PfamPF002491.1E-141966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-232073IPR009057Homeodomain-like
CDDcd001675.57E-112166No hitNo description
PROSITE profilePS5129426.05267121IPR017930Myb domain
SMARTSM007171.0E-1671119IPR001005SANT/Myb domain
PfamPF002492.0E-1572115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2574120IPR009057Homeodomain-like
CDDcd001672.65E-1274115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MDGGGESITA AKEVRGLKKG PWTATEDAIL TEYVRKHGEG NWNAVQKNSG LLRCGKSCRL  60
RWANHLRPNL KKGSFSPDEE RLIIELHAKH GNKWARMASQ LPGRTDNEIK NYWNTRMKRR  120
QRAGLPLYPQ EIHQGVDLDV GLDADELVSF GFQSQEHHQN MNPNSSNTPS SSSSFSSSSS  180
QPPKRLCLDP STSYNPSLNQ ISDSPMNYSS MFSLYNNTFH DHQNDNNNRF GFSLPLSSSS  240
SSSNELSNPN HLLEFNNGNN IDVLSYSSLL MGDHYNHHED NITPNSFLLQ NLELPSNQTT  300
SNTNKNGVFL DPPAANSGLL DALLMESQVL SRGGISKVSL SDSNENQDNK RVKIGDENRL  360
IDNLTSSTQS SIGTNPNSQN KNINEARIGN DENDDDDDDA FLMSLLNNFP ASTSLPWRIE  420
NQFEGSNNLA SPTGIYLGNS LVDPVTVQTS SSVDPMTSLG SCNWSNMPRI C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29171205107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00287DAPTransfer from AT2G32460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410379.11e-174hypothetical protein EUTSA_v10016567mg
TrEMBLV4M9P21e-174V4M9P2_EUTSA; Uncharacterized protein
STRINGAT2G32460.11e-172(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51002747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.11e-156myb domain protein 101